- NUFIP1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82515
- NUFIP1
- Unconjugated
- Human
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- NUFIP, Rsa1, bA540M5.1
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: SYYPRKYDAK FTDFSLPPSR KQKKKKRKEP VFHFFCDTCD RGFKNQEKYD KHMSEHTKCP ELDCSFTAHE KIVQFHWRNM
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- nuclear FMR1 interacting protein 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SYYPRKYDAKFTDFSLPPSRKQKKKKRKEPVFHFFCDTCDRGFKNQEKYDKHMSEHTKCPELDCSFTAHEKIVQFHWRNM
Specifications/Features
Available conjugates: Unconjugated